The Ghost Rider’s First Ride | Ghost Rider (2007)
2022 ж. 15 Там.
16 165 980 Рет қаралды
GHOST RIDER (2007) is NOW PLAYING and can be found to Rent or Buy here: DP.SonyPictures.com/GhostRider
Find the sequel here: DP.SonyPictures.com/GhostRider...
When motorcycle rider Johnny Blaze sells his soul to the Devil to save his father's life, he is transformed into the Ghost Rider, the Devil's own bounty hunter, and is sent to hunt down sinners.
Watch More:
► Need a Smile? Subscribe to Now Laughing: bit.ly/39UENSw
► Need a Fright? Subscribe to Now Scaring: bit.ly/39UENSw
► Have less time? Subscribe to Shorts: bit.ly/39UENSw
NOW SCARING is a channel made for movie fans, by movie fans. Here you will find all of the most memorable moments, scenes, trailers, and more from all of your favorite horror films.
No CGI just real life scenes captured by cameras. Nicolas cage is a legend
always
He really is every movie especially those thrillers are so good
@@kronos4669 tu chu h ..sarcasm tha uska comment
@@epicawesome5464 More!!
Can't believe Nicholas Cage actually had to burn all his skin and organs off just for this role
Anyone watching in 2024?
Yes sit🥷
Yes lot of people are watching this video in 2024
Ayooo
Hell 🥵🥵Yeah
No im from 1673
"He ain't so tough" gets hit with one punch n says have mercy 😂😂💀
😡😡
“Sorry. All out of mercy.”
But how did GR survive that truck?
@@dude-jk2hn when you think real hard about it the Ghost Rider is actually a spirit. Perhaps its hellish powers allowed it (and by extension, Johnny Blaze) to survive the truck crash unharmed ?
Ghost Riders can t be k illed by anything exc ept holy weapons
In 5:54 to 6:19 , It was still Johnny, screaming in pain. But in 6:20, it was already the Rider being glad and happy to be freed again in a new vessel.
I wouldn't say he was in a "new vessel"; I'd just say the Spirit of Vengeance is back on earth. Anyone could become the Ghost Rider, it just depends on what possesses you!
@@brennanhunt2722 i still don't get it
Cage improvised the laughing. He was really into the character.
Say what you want about this movie, but Nic cage killed it in this role. Especially this first transformation scene. Epic !
LMAO, No.....its a shit movie
Yeah... One of the best adaptations from Marvel
@@BonifaceJoseph what r u for real
@Most Heinous Gamer ! nah it is a bad film acting was okay would have benefit with competent writer though.
@@greatninja2590 it is no masterpiece, that is for sure...but it is still a fun movie to watch
“You’re going down” “Sorry, all outta mercy” Brilliant writing
It's like they wrote both lines expecting them to choose one for the final draft and then they just gave it to the other car instead
Shakespearean levels of writing.
Yeah, for the latter i woulda gone with "I am the Spirit of Vengeance...don't ask me for mercy."
Gressil: Have mercy Ghost Rider: Didn’t say “please”. Maybe not the best, but better IMO lol
Didn"t knew the Rider should be so eloquent...
The transformation scene is so accurate as to what might happen to someone in that amount of pain. While not as bad as it is to burn like he did from the inside out, I once experienced the same type of thing happen. I dislocated my left knee and instantly was on the ground. Pain was so bad that all I could do was laugh. Thought I was going crazy.
Well one coukd say that zatharos( the angle of vengeance inside cage) is coming out. Since zatharos is pretty much insane, those laughs could be him being happy hes finally been released
Calm down edgelord
@alexcorrales7322 I'm perfectly calm. Not sure how describing my own pain as well as giving an opinion on a movie makes me an "edgelord" wanna elaborate or are you just here to try and be a troll of some sort?
Cage's performance is so perfect, so sad it didn't hit. wish to see more cage play as role of superhero. he deserve more.
3:39 As a Biker I can confirm that this is what it feels like to go for the first ride after winter break :D
That's how I feel every year when I get on my Turbo 2 stroke snowmobile again. Haha.
U really had winter break...its just oosome feeling riding in winter in hills with sunshine...
It does it so does
Damn yeahhh 🔥🔥🔥🔥
Hahaha...every day after work
This movie was pretty raw for a 2000s movie, it still holds up pretty well and Peter Fonda did an incredible job as Mephistopheles.
he was in easy rider
More like Mephistopheles did an incredible job as Peter Fonda
As did Ghost Rider as legendary Nicolas Cage.
aLp
Acting opposite a Coppola, you need to go all in
6:43 I can only hear "spongebob is faithful" and I might never be able to unhear that.
Damn you Now I can't unhear it
Dammit man
Man I love how they didn’t use CGI for the transformation and instead just let Nicholas Cage use his own innate talent.
That laugh from Johnny is just amazing ...it's not him but the Rider inside him waiting to come out after a long time that's what makes him to laugh !!!!
u mean vengeance?
Like johnny himself is screaming in mortifying pain while the rider is laughing, finally being out again after years of being hidden, it makes sense because at first Johnny is screaming in pain and doesnt know what's going on but when his skull is exposed and in flames he turns to sudden laughter, amazing writing and acting, amazing
Not a rider inside Johnny. He was possessed by Nicholas Cage
Ahaha😂
It’s laughing at Johnnys futile attempt at trying to resist it lol
15 years later and this is still one of the coolest moments in marvel films. Just imagine this version of Ghost Rider in the MCU. Also Nicolas Cage always did have a way to just slay the crazy moments and that transformation really did show his abilities quite well
let's be honest here, whatever Disney can cook up right now could never be as cool as this
@@Deinobi I disagree; if Disney could work Cage into being an older Ghost Rider, like the cowboy one we get in this movie, it could easily surpass the cool factor! They’ve got the money for it, too!
@@Yodoggy9 disney only cares about money not the community
kzhead.info/sun/aq2vdcyEhXVqgY0/bejne.html🥰
@@Yodoggy9 yeah they would cast a female ghost rider and make all the males look bad
9:42 changing the sound of the engine to something demonic works perfectly
16 years later, and this is STILL one of the most well put together sequences in any marvel movie
Damn I remember watching this movie everyday after elementary school now I’m 21 and this shit still go hard
Facts makes me wanna ride
@@chasethemoney6129 fr fr
@@Simmychann fr fr fr
Yea I am 28
Same bro btw I'm 18 now
I really hope Nick's version of Ghost Rider exists somewhere out in the Multiverse for the MCU.
no doubt
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
He does. Everything goes. Even you 😉
@@Cerdo_asqueroso no need to spam the comments
@@Cerdo_asqueroso in all honesty I don’t think Johnny Depp would have suited the role of this character, nic performed perfectly he’s got that badass look to him and I think he pulled it off being the ghost rider I don’t think I can see Johnny being that sort of badass type. You have to admit we can’t unsee Nicolas as not being ghost rider. Despite how he got the role I 100% agree he nailed it for sure. Good on him👍🏻
This movie was gorgeous, I still came back to watch this scene over and over. It bring certain level of satisfaction inside of me that I can't articulate in human sense.
Anyone else love the soundtrack in this film? Especially those dark guitar riffs like at 1:28. Christopher Young doesn't get enough credit for his work. He also did the music for Spider-Man 3 btw.
Why did this movie receive so much hate? It looks Great
Don't care about the haters care about the lovers
It looks awfull dont lie
@@user-vr8fs8gg6h still much better than fat Thor and professor hulk
@@ameybirulkar7503 that sucks aswell but so does this
@@user-vr8fs8gg6h no
That motorcycle transformation at 9:15 is way more wicked than I remember Ghost Rider rocks!
I remember my dad showing me this movie in 2003 still a ghost rider fan today
The ghost rider's trasformation was like something beyond hell
You can tell that transformation was PAINFUL asf. From the first *GAHH* like he was literally getting burned away from the inside. They/Nick Cage did a great job at showing the pain Johnny was experiencing. Ik that had to have been literal torture especially with Zarathos taking over
This was by far the most malevolent character Peter Fonda ever played, but he pulled it off like no one else could. May an amazingly good actor rest in peace.
He really carried the film I thought.
জন দদভথলযতথযমতথথণচ
His transformation scene still gives me goosebumps, the cgi still holds up!!
for now...
You're kidding, right?
@@endeliggnist5066 I mean the transformation, like with his skin melting… not the ghost rider cgi.
@@xManAvengerdon't you know? That particular scene was completely improvised by Nic Cage, no CGI or whatever, the man simply unleashed his inner Cage, seeing this, the director just kept on filming, and his decision clearly paid off.
@@mamigyllenhaal2726 jqvfkdkkdkflfmkckfkfkfkkkkfkdikriirifirfkfxjjdjdjxjdkdkkddkkfrkfifkeiirfiieeiieifeifidiriddjrjkfrjfkrifkrifiririirjrirriirrjritkrkrrifkfjfiififijrrjrirfiriirririirifrjrirfirifirririirfirigirriitk😢❤😢😢😅😅😅😅😅😅😅😢😢😢😢😢😢😢😢😢😢😢😢😢🎉🎉🎉🎉😢😢😢😢😢😢😢😢😢kkdkfkrkiekdjdjdjiiddiififififjfifirfiririir😂y😢😮😮😮😮😮😮😢😮😮😢😢😢diiiidifiidififiifodorororroifjfrdidrjrifidifiifififdideirirrieisksiiswieieeieiddieiisieiieeeieieidieeeiieidieeiiieieieieeiiieeieeeieddieiririeieieieiieifoerere😂😂😊😅😊😊😊😊😊😊😊😊😊😊😊😊😊kdeiiddriridiriirrrrririrriirioroeoroerriiorrirrirririririeiirriirimhullggvkklfdjjkjjhhigdfgvjugzvcffffffbhggggffvgfgbgggnbhhjjhhhhhjjhhffgnkyhkjrdjyrfhhhgjjhhbggngfbhjnnjhtrnjhhhgbvvggjjgfffcdffffjifddhjjjddfmkm GvcdsssaZ😙😆😅🤣😀😍😭😁😅😆😅🥰🤩😊😍🥰😀😃😃😭😀🥰🥰😍🤩🤩😭🤣😆😘😂😊😅😘😆😁😁😀rhhhjbghnrbhnhghjhhhhhlheenhggffffgjyhrbregedhegretheefgerherbrgbrrtgggggffmmgdwqqwhkujjkkiookiiioigreseesghjjjjhfewqqjukjjjjyjjjtewqaaskouteyfhjiurrsdfhjiyyuffrrfjgyhggyygggttthrgbrgrghgrrrgfrrrrrrrffffffttrrreruiueueeueueeudeudeucrsnidjejjenjcejxjdjxeifrkicekidejiwiiedjsidjexidieijdcjdjejxjdsjxieidsidjjjjuwiejiedididiwiieiwidieisiudjdudidieisisidideiwixiweisieieoediidieekedkdkdoidididdiddjdjdi
Most believable live action transformation ive ever seen. The water starts to first burn away from his eyes since they have the most exposed mositure. The pain from his body completely burning away, then the euphoria of knowing secrets of the universe while also holding massive anounts of power realizing you now feel the best youve ever felt, all while experiencing the most intense pain you have ever felt, realizing its almost over and going absolutly fucking BALLS TO THE WALL PSYCHO haha.
This is definitely up there on my list of favorite transformations.
Great movie, just one thing annoying is that it doesn’t show the true power of the Ghost Rider. Literally one of the few Marvel characters to take out Thanos but for a 2000s movie this movie was great!
This is not great movie not 2000 movie is 2007 movie
Lmao it’s necessary to nerf OP characters buddy. Imagine if Lucifer(Netflix) was in accordance with his true powers per comics. There’d be no drama, no plot.
@@ludvighstrup4266 I meant as in a 2000s movie
@@Dante-tb7gc Why do they need to nerf him? If they brought the Ghost Rider back to the current MCU there’s quite a few opponents they can have challenge him and still have a great plot… Even tho Mephisto and his son were the main enemies in the comics and in these movies there are other powerful rivals of the Ghost Rider that they can make bad ass with the Cinematic Universe version 🤷♂️
Good for a 2000 movie lol. Bruh this is 2007. you do know movies like Lord of the Rings and The Matrix were already out by now. This movie is garbage and looks like a group of kids made it for highschool drama class. The story, the cgi, the acting. All terrible.
Nicolas Cage perfectly portrayed the burning alive from the inside. No one, I repeat - NO ONE could do that.
I can
I did it yesterday lol big deal
Have you never had a extra spicey Taco meal?
most people can lol
diarrhea
that bike transformation never gets old
One of the greatest acting performances I’ve ever witnessed. Thank you Nic Cage!
Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.
@@Cerdo_asqueroso I like Johny but i don't think he will fit for this role. Nic did a great job
@@Cerdo_asqueroso copy pasting the same shit in every thread?
@@personalclasslog6972 Oh I dont know what you are talking about. Maybe you are crazy, or maybe you saw a bot.
@@Cerdo_asqueroso nah you said the exact same thing under a different comment
I love this scene, I especially love how he transforms the bike and starts riding it by saying "It's Ghosting Time!"
Its Rider time
Ghost rider ghosted me 😤
It’s ridin’ time
Truly one of the scenes ever
My crush ghosted me
This movie and their *ODD* finger pointing thing is hilarious. Still love this movie foreverrrr
I love this movie. Its awesome.
I don't care how bad or good this movie was. All i want is another Ghost Rider movie in MCU but powerful as he is in comics.
@@SmartIndian_7337 is it good?
@@deadinside7002 lol when overproud indian people want you to watch that, of course its not good
@@deadinside7002 nope
@@ididntmeantoshootthatvietn5012 😂
@@ididntmeantoshootthatvietn5012 What they say to every Indian man who becomes an actor: Welcome to Bollywood - would like a mustache or a beard?
I like this version better than the second one. Mainly because the way his skin wad burning of seems like it would translate somewhat well into actual reality.
But the second is honestly good bc the fire is more realistic looking with the smoke coming off. And the fact that the bike, chain, and his clothes are bubbling like hot tar and charcoal black from the fire instead of this heavy metal looking skull look. It shows how the hellfire coming from Blaze is corrupting everything he's holding instead of just giving it a cool redesign. Zarathos was a corrupted angel of justice. Therefore his fire corrupts anything it touches.
I agree, but I wish they would have kept his Penance Stare the same as the first movie too, unless they did that to show he's an unstable Ghost rider lol
@@furionmax7824 my biggest problem was that they didn't keep it consistent, I like the way he is portrayed in 2 but it's to big of a change looking at the first movie.
@@Caliif well in the beginning it's implied he's been the rider for a while. He fled to a whole other continent bc he couldn't control zarathos anymore. But the change could've been done better. Like in the first one where his skin burns off. In this one it kind of just transitions I guess.
@@furionmax7824 they should have shown how he loses control in a flash back or in the first movie, because here he can control it he just isn't used to it and in the second it's instantly "it's to dangerous, I can't let him out"
Aside from pirates of the Caribbean series this is my best movie as a kid and even now. I just love all of it I can’t even cap
This movie is so underrated. I love it!!!
No 1can beat this movie in theaters.. 💞🔥turbo
I was 17 when I first watched this movie. The bike transformation scene was always badass to me.
heh
Hello 🤗
@@deadpool3466don't you remember the time he penance stared you?
@@jakobhardy1734 No. I could not see anything cuz my super suit was on me backwards on accident.
@@jakobhardy1734 what does penance mean? it sounds dangerously close to sounding like penis. Im worried.
Johnny: I'm not doing it Devil: you don't have any choice. So badass
Greatest scene ever in movies without doubt
I loved this movie. Way better then part 2. This was a classic, just like fantastic 4.
Ghost rider is one of the best and most underrated comic book character ever... Nic Cage was dope .. I've seen this movie in theatre and it's nuts..🔥
It's interesting how both movies have their own ups and downs. If only we could get the third one that would combine the best of two worlds.
Could u elaborate on what things did both movies do best in their own way ? Edit: I'm not mocking tho, just genuinely asking for ur opinion.
Two was shit to be honest, remake the second to fit the first narrative like the game did.
needs more metal music
The second one was God awful.
kzhead.info/sun/aq2vdcyEhXVqgY0/bejne.html
I remember seeing this transformation scene for the first time on the big screen. I went NUTS over this. I thought that it was one of the most EPIC scenes EVER!!!!! I was like "HOLY SHIT!!!!!!!!!"
This movie is what made Ghost Rider my #1 favorite Marvel hero
My favorite part of the whole movie is definitely this scene at 6:55. Wes Bentley's expressions are perfect with the Ghost Rider's punch lines :D
"You're going down!" "I don't think so" 10/10 performance right there
🥫🥫
Finally I funny KZheadr that goes straight into the clip thank you this is my favorite movie
The ominous mysterious music before his transformation, love when movies do that
7:50 Now That's what we call a brilliance
This guy has all this power but can't do it himself? Johnny has a point.
That's because it's not Mephistopheles's power. The Ghost Rider is Zarathos who is just under the control of Mephistopheles almost like a pet predator.
mephistopheles was always quite limited almost everywhere, he follows strictly his code, and it works
Say again, USA vs Russian every conflict last century?
The thing is Mephistopheles limited on Earth with his powers. That's why he needs Rider
The Ghost rider is pretty much what the Silver Surfer is to Galaxtos A supernatural herald lol
2:07 Nice bike! Peter Fonda remembering riding the Captain America chopper in Easy Riders?
My Dad bought me these comics in 1978. THank you Dad. Am sure you are in heaven.
That CG was great knowing that they did this in 2007, I love this movie. Hope they have variant of Cage's Johnny Blaze in MCU.
4:30 the cops was like" Okay I got it I won't be trying to catch him otherwise I'll make a fool out of myself"!😂
@@synophobia876 Tengen?
6:33 that evil laugh while trasnforming is iconic
i was blown away 10 years ago, and I am blown away now....
6:42 i like when he puting his head up while the music plays
A lot of people with myself included give Nic Cage credit for this scene and rightfully so. He's not so up his own ass that he's above going over the top and goofy for a transformation into an insane flaming demon.
😱
😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱
Even after all these years, this movie is still just SO FREAKING COOL! Don't care how old I get Ghost rider will always make me smile!
Ghost Rider & Nicholas Cage was perfect combination....no one can execute this role except Cage.
Keanu Reeves says hold my 🍺 😂😂😂 🍺
@@1motorcitychopI don't think he'd accept
@@1motorcitychopyes with his monotone ass voice. He couldn't do this.
I love the way the bike just threw him in the garage as if to say "we gotta do something about that skin John".
Couldn't put my finger on it, but I love how Mephisto, Blackheart, and The Hidden (Abigor, Gressil, and Wallow) talk in their normal voices, but you can hear the demonic background speech under their breath.
This movie is so freaking awesome. GREAT ACTORE JUST ABSOLUTELY AMAZING
Still gives me goosebumps
Thanos (to Thor): You should've gone for the head Ghost Rider (puts hand on Thanos shoulder): Hey...Dirtbag....
7:02 me confronting my cat on the counter at 3 AM eating the bread bag
Your cat: "We're not going to have a meaningful conversation now are we?"
Nic Cage was so perfect for this! We need him again.
Man I wish that we got an r rated ghost rider movie. This was a good movie but it sadly went unnoticed
I think the writing and storyline could’ve been done better, but I def don’t thinks it’s as bad as people make it to be
Doesn’t need to be r rated don’t need blood with ghost rider he leaves nothing but ash and brimstone and charred skeletons
5:15 that sound effect makes it looks as if the water guy just pop out of a bubble 🤣🤣
And Peter Fonda is marvelous in his acting as Mephistopheles!
Nic Cage really lit himself on fire for this scene
7:50 the camera work, the heavy footsteps, the "whatever" edgelord expression, the cheesy one liner, the green/blue color scheme. This all screams early 2000's and I love it lmao
This literally came out in 2007 wtf are you talking about
@@Luka2000_ 2000's means movies from 2000 to 2009 fucker
@@Luka2000_ Exactly? 2007 is still early 2000's
@@audax117 No. Stop huffing glue.
@@audax117 literally toilet brain
i love nicolas cage as johnny great acting you can see how johnny is getting high in the power until he looks at his hands and he realizes hes burning, power and fear fight and fear dies sheeesh i hope we see him again
You wont believe the happiness I got from watching this
From childhood always my fav movie but those dialogues i undrstood now , its really humourous 😂 like hows my driving written on truck after hitting GR 😂 and many instances i still laugh like hell 🤣🤣🤣 he was the deadpool of that time i must say most badass 😂
That scene where horse ghost rider & cage go for a ride always gave me goosebumps as a teenager..Movie was great for the 2000s ..But also I felt like it went downhill after the first movie
I VERY MUCH AGREE WITH YOU,MULAMU....
Nick may be the greatest actor alive today. From performance to keeping his life in check and keep his private life private, a true gift for mankind.
Dude spends thousands of dollars on the craziest shit left and right and ends up with insane debts he has to pay with his movies. Can't call that 'keeping his life in check' LMAO He is a pretty chill dude tho, and I love his mindset on acting. Definitely an interesting guy.
He did quite a lot of lame movies and some outright trash ....
Said nobody ever.
This is is all about the design. Ghost rider looks metal as hell.
The bike transformation is the best..very nice Cgi..
4:26 i feel they missed a trick the speed gun should’ve recorded 666
Hahahaha... nice one !
speed gun can’t track anything above 300 range
@@Luis-tz8kt like this movie follows any like of logic or realism?
“Please, have mercy” Bro you just hit me with a semi
I love it when he says all out of mercy.
That’s one hell of an entrance.
That whistle at 09:07 😵
Cartoons...
@8:46 his human scream muffled by the demon scream is terrifyingly good! Gives you a sense of how powerful the rider is. Granted I don't know much about the history of Ghost Rider. So I don't know how powerful he really is.
He is strong that he beat doctor strange by just staring at him and fight the avengers by himself alone and beat galactus by staring at him.
He's pretty op
ghost rider could solo the entire avengers pretty ez, thats how powerful he is. If he joined MCU there would be no need for Endgame cause he would kill thanos by staring at him3
@@losever1177 really? Do you know the comics name? I want to read it, because it sounds very cool 😂
This is definitely my most favorite movie with the marvelous Actor - Nicolas Cage!
The bike was legendary asf too gadamn 🥶🥶🔥
6:33 is me when i finally get the last kill on fortnite😂😂
Love how the bike has its own personality and mind of it's own.
Still love this
remembered this childhood movie , still look awesome to this day
7:16 ahhh yes. . . Air, Water, and truck driver
6:23 normal tuesday for nicolas cage
If you watch the whole sequence of him doing a 'pop-o-wheelie' @3:54 and watch it at 0.25x speed - you will see it was Tom Cruise who did the bike stunt for Nick Cage.
I'm really impressed with this channel, the content is very interesting and informative. Keep innovating and producing high-quality content. The portrayal of the Ghost Rider character is spot-on in this film. The story is engaging, the action is intense, and the visuals are stunning. Definitely one of my favorite superhero movies. 👍
8:57 and that kids, is where gravel comes from
Demon: have mercy Rider : ooh at of mercy. That line.. Madddd
Sorry All outta mercy 😄